Atlas Antibodies Anti-MCCC2 Antibody

상품 한눈에 보기

인간 MCCC2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용하여 제작되었으며, RNA-seq 데이터 기반의 직교 검증을 통해 신뢰성을 확보했습니다. 글리세롤 및 PBS 완충액에 보존됩니다.

카탈로그번호: HPA061546-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061546-100 Anti-MCCC2 Antibody, methylcrotonoyl-CoA carboxylase 2 (beta) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061546-25 Anti-MCCC2 Antibody, methylcrotonoyl-CoA carboxylase 2 (beta) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MCCC2 Antibody

Anti-MCCC2 Antibody

Target: methylcrotonoyl-CoA carboxylase 2 (beta)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression of the target.
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human MCCC2 (methylcrotonoyl-CoA carboxylase 2, beta subunit).

Alternative Gene Names

MCCB

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:

GIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADE

Species Reactivity

Verified: Human
Ortholog Identity:
- Mouse (ENSMUSG00000021646): 90%
- Rat (ENSRNOG00000017752): 90%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand