CacheBy
Atlas Antibodies Anti-MCCC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MCCC1 Antibody

상품 한눈에 보기

Human MCCC1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Rabbit에서 생산되었으며 IgG 아이소타입입니다. PrEST 항원을 이용해 친화 정제되었고, PBS와 글리세롤 버퍼에 보관됩니다.

카탈로그번호
HPA008310-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008310-100 Anti-MCCC1 Antibody, methylcrotonoyl-CoA carboxylase 1 (alpha) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008310-25 Anti-MCCC1 Antibody, methylcrotonoyl-CoA carboxylase 1 (alpha) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MCCC1 Antibody

Anti-MCCC1 Antibody

Target: methylcrotonoyl-CoA carboxylase 1 (alpha)
Gene: MCCC1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MCCC1 (methylcrotonoyl-CoA carboxylase 1, alpha).

Alternative Gene Names: MCCA

Open Datasheet


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ITGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEARIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIETGVRQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFIPQHH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000027709): 90%
  • Rat (ENSRNOG00000013293): 90%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using PrEST antigen
Storage Store at recommended conditions; mix gently before use
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.