Atlas Antibodies Anti-MBD5 Antibody
상품 한눈에 보기
Human MBD5 단백질을 인식하는 Rabbit Polyclonal 항체로, 메틸화 CpG 결합 단백질 연구에 적합. 고순도 Affinity purification 방식으로 제조. 인간에 대한 검증 완료. 다양한 응용 실험에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MBD5 Antibody
Target: methyl-CpG binding domain protein 5 (MBD5)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human MBD5, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
FLJ11113, KIAA1461
Target Information
- Target Protein: methyl-CpG binding domain protein 5
- Target Gene: MBD5
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000036792 | 97% |
| Rat | ENSRNOG00000027596 | 89% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
ICC (Immunocytochemistry)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.