AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MBD5 Antibody
상품 한눈에 보기
Human MBD5 단백질을 인식하는 Rabbit Polyclonal 항체로, 메틸화 CpG 결합 단백질 연구에 적합. 고순도 Affinity purification 방식으로 제조. 인간에 대한 검증 완료. 다양한 응용 실험에 활용 가능.
- 카탈로그번호
- HPA035964-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035964-100 Anti-MBD5 Antibody, methyl-CpG binding domain protein 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035964-25 Anti-MBD5 Antibody, methyl-CpG binding domain protein 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MBD5 Antibody
Anti-MBD5 Antibody
Target: methyl-CpG binding domain protein 5 (MBD5)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human MBD5, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
FLJ11113, KIAA1461
Target Information
- Target Protein: methyl-CpG binding domain protein 5
- Target Gene: MBD5
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000036792 | 97% |
| Rat | ENSRNOG00000027596 | 89% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
ICC (Immunocytochemistry)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.