Atlas Antibodies Anti-MARCO Antibody

상품 한눈에 보기

Human MARCO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. PrEST 항원으로 정제되었으며, RNA-seq 데이터와의 직교 검증을 통해 신뢰성 높은 단백질 발현 분석을 제공합니다. Human에 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA063793-100 Anti-MARCO Antibody, macrophage receptor with collagenous structure 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA063793-25 Anti-MARCO Antibody, macrophage receptor with collagenous structure 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

macrophage receptor with collagenous structure

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal antibody against Human MARCO.

항목	내용
Target Protein	macrophage receptor with collagenous structure
Target Gene	MARCO
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000049303 (57%), Mouse ENSMUSG00000026390 (52%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand