
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MARCO Antibody
상품 한눈에 보기
Human MARCO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. PrEST 항원으로 정제되었으며, RNA-seq 데이터와의 직교 검증을 통해 신뢰성 높은 단백질 발현 분석을 제공합니다. Human에 반응성이 검증되었습니다.
- 카탈로그번호
- HPA063793-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA063793-100 Anti-MARCO Antibody, macrophage receptor with collagenous structure 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063793-25 Anti-MARCO Antibody, macrophage receptor with collagenous structure 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MARCO Antibody
Anti-MARCO Antibody
macrophage receptor with collagenous structure
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human MARCO.
Alternative Gene Names
- SCARA2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | macrophage receptor with collagenous structure |
| Target Gene | MARCO |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000049303 (57%), Mouse ENSMUSG00000026390 (52%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



