
Atlas Antibodies Anti-MARCO Antibody
상품 한눈에 보기
Human MARCO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. PrEST 항원으로 정제되었으며, RNA-seq 데이터와의 직교 검증을 통해 신뢰성 높은 단백질 발현 분석을 제공합니다. Human에 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MARCO Antibody
macrophage receptor with collagenous structure
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human MARCO.
Alternative Gene Names
- SCARA2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | macrophage receptor with collagenous structure |
| Target Gene | MARCO |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000049303 (57%), Mouse ENSMUSG00000026390 (52%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MARK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MARK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MARCO Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MARCKSL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MARCKS Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.