
Atlas Antibodies Anti-MARCH3 Antibody
상품 한눈에 보기
Human MARCH3 단백질을 표적으로 하는 폴리클론 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Recombinant expression 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human 반응성 확인 및 Mouse, Rat과 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MARCH3 Antibody
Target: membrane-associated ring finger (C3HC4) 3, E3 ubiquitin protein ligase
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human MARCH3
Alternative Gene Names
MARCH-III, MGC48332, RNF173
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | membrane-associated ring finger (C3HC4) 3, E3 ubiquitin protein ligase |
| Target Gene | MARCH3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000032656 (96%) Rat ENSRNOG00000023013 (94%) |
Antigen Sequence:
FRYHCRLYNEWRRTNQRVILLIPKSVNVPSNQPSLLGLHSVKRNSKETVV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MARCH5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAPT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MARCH3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MARCH10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MARC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.