
Atlas Antibodies Anti-MAP4 Antibody
상품 한눈에 보기
인간 MAP4 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에서 검증되었으며, 토끼 IgG 아이소타입입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAP4 Antibody
Target: microtubule-associated protein 4 (MAP4)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human MAP4.
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | microtubule-associated protein 4 |
| Target Gene | MAP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPIKDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMISPETVTGT |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000020748 (45%) Mouse ENSMUSG00000032479 (41%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP4K4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP4K1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP4K2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.