
Atlas Antibodies Anti-MAP2K5 Antibody
상품 한눈에 보기
인간 MAP2K5 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 다양한 종 간 높은 서열 유사성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAP2K5 Antibody
mitogen-activated protein kinase kinase 5
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human MAP2K5.
Alternative Gene Names
HsT17454, MAPKK5, MEK5, PRKMK5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitogen-activated protein kinase kinase 5 |
| Target Gene | MAP2K5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007926 (99%), Mouse ENSMUSG00000058444 (97%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAP2K7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP3K10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2K5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2K7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.