
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAP1LC3A Antibody
상품 한눈에 보기
Human MAP1LC3A 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC 및 WB용으로 검증된 고품질 제품. PrEST 항원을 이용한 친화 정제 방식. 인간, 마우스, 랫트에서 100% 교차 반응성 확인.
- 카탈로그번호
- HPA052474-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052474-100 Anti-MAP1LC3A Antibody, microtubule-associated protein 1 light chain 3 alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052474-25 Anti-MAP1LC3A Antibody, microtubule-associated protein 1 light chain 3 alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAP1LC3A Antibody
Anti-MAP1LC3A Antibody
microtubule-associated protein 1 light chain 3 alpha
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Recombinant expression validation (WB)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human MAP1LC3A
Alternative Gene Names
ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | microtubule-associated protein 1 light chain 3 alpha |
| Target Gene | MAP1LC3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027602 (100%) Rat ENSRNOG00000025443 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



