
Atlas Antibodies Anti-MAP1LC3A Antibody
Human MAP1LC3A 단백질을 표적으로 하는 폴리클로날 토끼 항체. IHC 및 WB용으로 검증된 고품질 제품. PrEST 항원을 이용한 친화 정제 방식. 인간, 마우스, 랫트에서 100% 교차 반응성 확인.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAP1LC3A Antibody
microtubule-associated protein 1 light chain 3 alpha
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Recombinant expression validation (WB)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human MAP1LC3A
Alternative Gene Names
ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | microtubule-associated protein 1 light chain 3 alpha |
| Target Gene | MAP1LC3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027602 (100%) Rat ENSRNOG00000025443 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAP1S Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP1LC3B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP1LC3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP1LC3C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP1A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|