
Atlas Antibodies Anti-MAD1L1 Antibody
상품 한눈에 보기
인간 MAD1L1 단백질에 대한 폴리클로날 항체로, IHC와 WB에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 반응성이 검증되어 있으며, 세포주기 관련 연구에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAD1L1 Antibody
Target: MAD1 mitotic arrest deficient-like 1 (yeast)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human MAD1L1.
Alternative Gene Names
HsMAD1, MAD1, PIG9, TP53I9, TXBP181
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | MAD1 mitotic arrest deficient-like 1 (yeast) |
| Target Gene | MAD1L1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000001265 (79%), Mouse ENSMUSG00000029554 (79%) |
Antigen Sequence
TKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLEIRRAPPLSNN
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAD2L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAD2L1BP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAD1L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MACF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MACF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.