원본

Atlas Antibodies Anti-LZTS1 Antibody

상품 한눈에 보기

Human LZTS1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Recombinant expression validation을 거쳐 신뢰성 높은 결과를 제공합니다. Rabbit 유래 IgG, PrEST 항원 기반 친화 정제.

카탈로그번호: HPA022046-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA022046-100 Anti-LZTS1 Antibody, leucine zipper, putative tumor suppressor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA022046-25 Anti-LZTS1 Antibody, leucine zipper, putative tumor suppressor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-LZTS1 Antibody

Anti-LZTS1 Antibody

Target: leucine zipper, putative tumor suppressor 1
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human LZTS1

Alternative Gene Names

FEZ1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	leucine zipper, putative tumor suppressor 1
Target Gene	LZTS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000011826 (86%), Mouse ENSMUSG00000036306 (85%)

Antigen Sequence:
TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKE

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand