
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LZTS1 Antibody
상품 한눈에 보기
인간 LZTS1 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 발현 검증 완료된 고품질 항체이며, 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA006294-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA006294-100 Anti-LZTS1 Antibody, leucine zipper, putative tumor suppressor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006294-25 Anti-LZTS1 Antibody, leucine zipper, putative tumor suppressor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LZTS1 Antibody
Anti-LZTS1 Antibody
Target: leucine zipper, putative tumor suppressor 1 (LZTS1)
Type: Polyclonal Antibody against Human LZTS1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Alternative Gene Names
- FEZ1
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000011826 | 86% |
| Mouse | ENSMUSG00000036306 | 85% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



