AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LZTR1 Antibody
상품 한눈에 보기
Human LZTR1 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 유래 IgG로 PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 PBS 버퍼에 보존제를 포함합니다.
- 카탈로그번호
- HPA068772-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA068772-100 Anti-LZTR1 Antibody, leucine-zipper-like transcription regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068772-25 Anti-LZTR1 Antibody, leucine-zipper-like transcription regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LZTR1 Antibody
Anti-LZTR1 Antibody
Target: leucine zipper like transcription regulator 1 (LZTR1)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human LZTR1.
Alternative Gene Names
BTBD29, LZTR-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine zipper like transcription regulator 1 |
| Target Gene | LZTR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence (Epitope) | TQPASELPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWESRQFCDVEFVLGEKEECVQGHVAIVTA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity:
- Rat (ENSRNOG00000001870): 95%
- Mouse (ENSMUSG00000022761): 95%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.