AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LZTFL1 Antibody
상품 한눈에 보기
인간 LZTFL1 단백질을 인식하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용해 높은 특이성과 재현성 확보. 토끼 유래 IgG 항체로 PBS/glycerol buffer에 보존.
- 카탈로그번호
- HPA048447-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048447-100 Anti-LZTFL1 Antibody, leucine zipper transcription factor-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048447-25 Anti-LZTFL1 Antibody, leucine zipper transcription factor-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LZTFL1 Antibody
Anti-LZTFL1 Antibody
Target: leucine zipper transcription factor-like 1 (LZTFL1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation using RNA-seq data comparison in high/low expression tissues)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human LZTFL1 (leucine zipper transcription factor-like 1).
Alternative Gene Names
- BBS17
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine zipper transcription factor-like 1 |
| Target Gene | LZTFL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLN |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Orthologs (Identity) | Mouse ENSMUSG00000025245 (88%), Rat ENSRNOG00000006244 (87%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.