AI 생성

1 / 2

Atlas Antibodies Anti-LYSMD1 Antibody

상품 한눈에 보기

인간 LYSMD1 단백질을 타겟으로 하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 재조합 발현 검증 완료, 친화도 정제 방식으로 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 항체이며 인간 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028055-100 Anti-LYSMD1 Antibody, LysM, putative peptidoglycan-binding, domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028055-25 Anti-LYSMD1 Antibody, LysM, putative peptidoglycan-binding, domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

LysM, putative peptidoglycan-binding, domain containing 1

IHC (Immunohistochemistry)
WB (Western Blot) — Recombinant expression validation using target protein overexpression
ICC (Immunocytochemistry)

Polyclonal antibody against human LYSMD1.

MGC35223, RP11-68I18.5, SB145

항목	내용
Target Protein	LysM, putative peptidoglycan-binding, domain containing 1
Target Gene	LYSMD1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat (88%), Mouse (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

PTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation
ICC Application

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.