
Atlas Antibodies Anti-LYSMD1 Antibody
상품 한눈에 보기
인간 LYSMD1 단백질을 타겟으로 하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 재조합 발현 검증 완료, 친화도 정제 방식으로 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 항체이며 인간 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LYSMD1 Antibody
LysM, putative peptidoglycan-binding, domain containing 1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human LYSMD1.
Alternative Gene Names
MGC35223, RP11-68I18.5, SB145
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LysM, putative peptidoglycan-binding, domain containing 1 |
| Target Gene | LYSMD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (88%), Mouse (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
PTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKLNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LYSMD3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LYSMD4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LYSMD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LYRM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LYRM7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.