
Atlas Antibodies Anti-LYPLA1 Antibody
상품 한눈에 보기
Human LYPLA1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 사람, 생쥐, 랫드 간 교차 반응성이 확인되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LYPLA1 Antibody
Target Protein: lysophospholipase I (LYPLA1)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human LYPLA1.
Alternative Gene Names
- LPL1
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
LTTQQKLAGVTALNCWLPLWASFPQGPIGGANRDISILQCHGDCDPLV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000025903 | 88% |
| Rat | ENSRNOG00000008320 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LYPD3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LYPD5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LYPLA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LYPD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LYG2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.