
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LURAP1 Antibody
상품 한눈에 보기
Human LURAP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 재조합 발현 검증 완료. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적 반응성을 가지며 높은 종간 서열 유사성을 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030060-100 Anti-LURAP1 Antibody, leucine rich adaptor protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030060-25 Anti-LURAP1 Antibody, leucine rich adaptor protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LURAP1 Antibody
Anti-LURAP1 Antibody
leucine rich adaptor protein 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human LURAP1.
Alternative Gene Names
C1orf190, FLJ25163, LRAP35a
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich adaptor protein 1 |
| Target Gene | LURAP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000023459 (93%), Mouse ENSMUSG00000028701 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



