
Atlas Antibodies Anti-LURAP1 Antibody
상품 한눈에 보기
Human LURAP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며 재조합 발현 검증 완료. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적 반응성을 가지며 높은 종간 서열 유사성을 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LURAP1 Antibody
leucine rich adaptor protein 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human LURAP1.
Alternative Gene Names
C1orf190, FLJ25163, LRAP35a
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich adaptor protein 1 |
| Target Gene | LURAP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000023459 (93%), Mouse ENSMUSG00000028701 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LURAP1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LUZP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LURAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LURAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LUZP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.