AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LTV1 Antibody
상품 한눈에 보기
Human LTV1 리보솜 생합성 인자를 표적하는 폴리클로날 항체. Rabbit 유래 IgG 형태로 IHC, ICC 등 다양한 연구 응용 가능. PrEST 항원으로 친화 정제됨. Human에 대해 검증된 반응성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030160-100 Anti-LTV1 Antibody, LTV1 ribosome biogenesis factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030160-25 Anti-LTV1 Antibody, LTV1 ribosome biogenesis factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LTV1 Antibody
Anti-LTV1 Antibody
Target Information
- Target Protein: LTV1 ribosome biogenesis factor
- Target Gene: LTV1
- Alternative Gene Names: C6orf93, dJ468K18.4, FLJ14909
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human LTV1 ribosome biogenesis factor.
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
ATGEEEGMDIQKSENEDDSEWEDVDDEKGDSNDDYDSAGLLSDEDCMSVPGKTHRAIADHLFWSEETKSRFTEYSM
Species Reactivity
- Verified Species Reactivity: Human
- Interspecies Information:
- Mouse ENSMUSG00000019814 (55%)
- Rat ENSRNOG00000015217 (49%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.