
Thermo Fisher Scientific Gm5581 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 Gm5581 폴리클로날 항체는 마우스 Gm5581 단백질을 인식하는 Rabbit IgG 기반 항체입니다. Western blot에 적합하며, 합성 펩타이드로 면역화되었습니다. 액상 형태로 제공되며, -20°C에서 장기 보관 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific Gm5581 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the middle region of mouse Gm5581 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.0 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2689958 |
Product Specific Information
- Target homology: Cow 92%, Dog 92%, Human 100%, Pig 92%
- Peptide sequence: EEWECLDSAQRDLYRDVMLENYHNLVSVGVAVSKSEVIFCLEQNNESWIA
- For short term use, store at 2–8°C up to 1 week.
- For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
- Concentration is batch dependent: 0.5–1 mg/mL
Target Information
Gm5581 is a protein coding gene.
Note: For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific ARIH2 Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific GTF3C5 Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific Gm5581 Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific POU3F3 Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific PCSK6 Polyclonal Antibody
642,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.