Thermo Fisher Scientific Bax Polyclonal Antibody
BAX 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot, IHC, Flow cytometry 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 인간, 마우스, 랫트 반응성을 가집니다. 세포 사멸 연구에 유용합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Bax Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10^6 cells | - |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17–48 aa: EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745973 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
BAX is a member of the Bcl-2 family and plays a crucial role in the regulation of apoptosis. While Bcl-2 acts as an anti-apoptotic protein, BAX promotes apoptosis. Regulation of apoptosis involves both homo- and heterodimerization of various isoforms of BAX and Bcl-2.
The Bax gene encodes multiple isoforms, including Bax alpha (21 kDa) and Bax beta (24 kDa). Both contain BH1, BH2, and BH3 domains, but Bax beta has a unique C-terminus lacking a hydrophobic transmembrane domain.
Bcl-2 also exists in multiple isoforms; Bcl-2 beta differs in both UTR and coding regions compared to the alpha variant, resulting in a shorter (22 kDa) protein with a distinct C-terminus.
Overexpression of BAX promotes cell death through homodimerization and heterodimerization with other BCL-2 family members.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.