Thermo Fisher Scientific Bax Polyclonal Antibody
BAX 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot, IHC, Flow cytometry 등 다양한 응용에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 인간, 마우스, 랫트 반응성을 가집니다. 세포 사멸 연구에 유용합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10^6 cells | - |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17–48 aa: EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2745973 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
BAX is a member of the Bcl-2 family and plays a crucial role in the regulation of apoptosis. While Bcl-2 acts as an anti-apoptotic protein, BAX promotes apoptosis. Regulation of apoptosis involves both homo- and heterodimerization of various isoforms of BAX and Bcl-2.
The Bax gene encodes multiple isoforms, including Bax alpha (21 kDa) and Bax beta (24 kDa). Both contain BH1, BH2, and BH3 domains, but Bax beta has a unique C-terminus lacking a hydrophobic transmembrane domain.
Bcl-2 also exists in multiple isoforms; Bcl-2 beta differs in both UTR and coding regions compared to the alpha variant, resulting in a shorter (22 kDa) protein with a distinct C-terminus.
Overexpression of BAX promotes cell death through homodimerization and heterodimerization with other BCL-2 family members.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific BAG3 Polyclonal Antibody
621,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BCAT2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Bax Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BAG1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ADC Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|