
Atlas Antibodies Anti-ANGPTL2 Antibody
인간 ANGPTL2 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤/PBS 완충액에 보존되어 장기 보관이 용이합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ANGPTL2 Antibody
Target Information
- Target Protein: angiopoietin-like 2
- Target Gene: ANGPTL2
- Alternative Gene Names: ARP2, HARP
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.
Product Description
Polyclonal Antibody against Human ANGPTL2
Host: Rabbit
Isotype: IgG
Clonality: Polyclonal
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
QEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000004105): 89%
- Rat (ENSRNOG00000016678): 88%
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ANK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANGPTL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANGPTL3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANGPTL5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|