
Atlas Antibodies Anti-ANG Antibody
상품 한눈에 보기
Human ANG(angiogenin)을 인식하는 rabbit polyclonal antibody로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, glycerol 및 PBS buffer로 안정화됨. ANG 유전자 연구 및 단백질 발현 분석에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ANG Antibody
Target Information
- Target Protein: angiogenin
- Target Gene: ANG
- Alternative Gene Names: RAA1, RNASE5
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human ANG.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGN
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000072115): 73%
- Rat (ENSRNOG00000025562): 73%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ANGPT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANGEL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANGEL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANAPC4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.