
1 / 2
Atlas Antibodies Anti-ALKBH6 Antibody
상품 한눈에 보기
인간 ALKBH6 단백질을 인식하는 토끼 폴리클로날 항체입니다. 면역형광 등 다양한 연구 응용에 적합하며, PrEST 항원을 이용해 친화정제되었습니다. 인간에 대한 반응성이 검증되었으며, 글리세롤 및 PBS 완충액에 보존됩니다. 사용 전 부드럽게 혼합하고, 최적 조건은 사용자가 실험에 맞게 조정해야 합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ALKBH6 Antibody
Target Protein: alkB homolog 6
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human ALKBH6.
Alternative Gene Names
MGC15677
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | alkB homolog 6 |
| Target Gene | ALKBH6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000042831 (68%), Rat ENSRNOG00000047943 (67%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Recommended Applications
- Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ALKBH7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.