
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ALKBH6 Antibody
상품 한눈에 보기
인간 ALKBH6 단백질을 인식하는 토끼 폴리클로날 항체입니다. 면역형광 등 다양한 연구 응용에 적합하며, PrEST 항원을 이용해 친화정제되었습니다. 인간에 대한 반응성이 검증되었으며, 글리세롤 및 PBS 완충액에 보존됩니다. 사용 전 부드럽게 혼합하고, 최적 조건은 사용자가 실험에 맞게 조정해야 합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA074340-100 Anti-ALKBH6 Antibody, alkB homolog 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074340-25 Anti-ALKBH6 Antibody, alkB homolog 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ALKBH6 Antibody
Anti-ALKBH6 Antibody
Target Protein: alkB homolog 6
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human ALKBH6.
Alternative Gene Names
MGC15677
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | alkB homolog 6 |
| Target Gene | ALKBH6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000042831 (68%), Rat ENSRNOG00000047943 (67%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Recommended Applications
- Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



