CacheBy
Atlas Antibodies Anti-ALG10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALG10 Antibody

상품 한눈에 보기

Human ALG10 단백질을 인식하는 토끼 폴리클로날 항체. IHC와 Western Blot에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성(인간-마우스/랫트 97%)을 보임. 40% 글리세롤 및 PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA063387-100 Anti-ALG10 Antibody, ALG10, alpha-1,2-glucosyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063387-25 Anti-ALG10 Antibody, ALG10, alpha-1,2-glucosyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALG10 Antibody

Anti-ALG10 Antibody

Target: ALG10, alpha-1,2-glucosyltransferase
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ALG10.


Alternative Gene Names

ALG10A, DIE2, FLJ14751

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ALG10, alpha-1,2-glucosyltransferase
Target Gene ALG10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP
Verified Species Reactivity Human
Interspecies Identity Mouse (97%), Rat (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.