CacheBy
Atlas Antibodies Anti-ALDOC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALDOC Antibody

상품 한눈에 보기

Human ALDOC 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation으로 검증되었으며, 고순도의 친화 정제 방식으로 제조되었습니다. Human, Mouse, Rat에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA003282-100 Anti-ALDOC Antibody, aldolase C, fructose-bisphosphate 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003282-25 Anti-ALDOC Antibody, aldolase C, fructose-bisphosphate 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALDOC Antibody

Anti-ALDOC Antibody

Target: aldolase C, fructose-bisphosphate

  • IHC (Orthogonal validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human ALDOC

Open Datasheet

Target Information

항목 내용
Target Protein aldolase C, fructose-bisphosphate
Target Gene ALDOC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI

Species Reactivity

종 반응성
Human ✔
Mouse ✔
Rat ✔

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000011452 (100%)
  • Mouse ENSMUSG00000017390 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.