
Atlas Antibodies Anti-AKAP3 Antibody
상품 한눈에 보기
Human AKAP3 단백질을 인식하는 토끼 다클론 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 교차 검증에 적합. PrEST 항원으로 친화 정제되었으며, 고순도의 신뢰성 있는 단백질 발현 검증용 시약.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AKAP3 Antibody
A kinase (PRKA) anchor protein 3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human AKAP3
Alternative Gene Names
AKAP110, CT82, FSP95, SOB1
Specification
| 항목 | 내용 |
|---|---|
| Target Protein | A kinase (PRKA) anchor protein 3 |
| Target Gene | AKAP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AQGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCERP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000059227 (61%), Mouse ENSMUSG00000030344 (60%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-AKAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AKAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AKAP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AKAP17A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AKAP14 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.