Atlas Antibodies Anti-AKAP3 Antibody

상품 한눈에 보기

Human AKAP3 단백질을 인식하는 토끼 다클론 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 교차 검증에 적합. PrEST 항원으로 친화 정제되었으며, 고순도의 신뢰성 있는 단백질 발현 검증용 시약.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039765-100 Anti-AKAP3 Antibody, A kinase (PRKA) anchor protein 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039765-25 Anti-AKAP3 Antibody, A kinase (PRKA) anchor protein 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

A kinase (PRKA) anchor protein 3

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human AKAP3

AKAP110, CT82, FSP95, SOB1

항목	내용
Target Protein	A kinase (PRKA) anchor protein 3
Target Gene	AKAP3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	AQGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCERP
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000059227 (61%), Mouse ENSMUSG00000030344 (60%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand