
Atlas Antibodies Anti-AKAP17A Antibody
상품 한눈에 보기
Human AKAP17A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 검증을 통해 단백질 발현을 확인함. PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 데이터와 비교한 Orthogonal validation 제공. Human에 특이적으로 반응.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AKAP17A Antibody
A kinase (PRKA) anchor protein 17A
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human AKAP17A
Alternative Gene Names
721P, CCDC133, CXYorf3, DXYS155E, MGC39904, SFRS17A, XE7, XE7Y
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | A kinase (PRKA) anchor protein 17A |
| Target Gene | AKAP17A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000059708 (41%), Rat ENSRNOG00000009746 (41%) |
Antigen Sequence:
GEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVF
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-AKAP14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AKAP13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AKAP17A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AKAP12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AK9 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.