Atlas Antibodies Anti-AIDA Antibody
Human AIDA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 및 PBS 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AIDA Antibody
Target Protein: axin interactor, dorsalization associated
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human AIDA (axin interactor, dorsalization associated).
Alternative Gene Names
C1orf80, FLJ12806
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000042901 (96%)
- Rat ENSRNOG00000058805 (96%)
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| 제품명 | Anti-AIDA Antibody |
| 타깃 단백질 | axin interactor, dorsalization associated (AIDA) |
| 대체 유전자명 | C1orf80, FLJ12806 |
| 항체 유형 | Polyclonal |
| 숙주 | Rabbit |
| 아이소타입 | IgG |
| 정제 방법 | PrEST 항원을 이용한 친화 정제 |
| 적용 분야 | IHC, WB, ICC |
| 반응 종 | Human |
| 보존 용액 | 40% Glycerol, PBS (pH 7.2), 0.02% Sodium Azide |
| 항원 서열 | EEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVS |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|