
Atlas Antibodies Anti-LRRC9 Antibody
상품 한눈에 보기
Human LRRC9 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 기반 완충액에 보존됩니다. 인간에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRRC9 Antibody
Target: Leucine Rich Repeat Containing 9 (LRRC9)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal Antibody against Human LRRC9
Alternative Gene Names
- FLJ46156
Target Information
| 구분 | 내용 |
|---|---|
| Target Protein | Leucine rich repeat containing 9 |
| Target Gene | LRRC9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SFKELTNLTRLPCLKDLCLNDPQYTTNPVCLLCNYSTHVLYHLPCLQRFDTLDVSAKQIKELADTTAMKKIMYYNMRIKTLQRHLKEDLEKLNDQKCKLQKLPE |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021090 | 86% |
| Rat | ENSRNOG00000005409 | 86% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LRRC75B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC8B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC75A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.