Atlas Antibodies Anti-AGMAT Antibody
상품 한눈에 보기
인간 AGMAT 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 정량적 단백질 발현 검증에 사용됩니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적이며, RNA-seq 데이터 기반 직교 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AGMAT Antibody
agmatine ureohydrolase (agmatinase)
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human AGMAT
Alternative Gene Names
- FLJ23384
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | agmatine ureohydrolase (agmatinase) |
| Target Gene | AGMAT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHG |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000012315 (80%), Mouse ENSMUSG00000040706 (79%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.