AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC17 Antibody
상품 한눈에 보기
Human LRRC17 단백질을 인식하는 토끼 폴리클로날 항체로, 다양한 면역학적 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA073458-100 Anti-LRRC17 Antibody, leucine rich repeat containing 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073458-25 Anti-LRRC17 Antibody, leucine rich repeat containing 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC17 Antibody
Anti-LRRC17 Antibody
Target: leucine rich repeat containing 17 (LRRC17)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC) 등 다양한 면역학적 분석에 사용 가능
Product Description
Polyclonal antibody against human LRRC17 protein.
Alternative Gene Names
H_RG318M05.3, P37NB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 17 |
| Target Gene | LRRC17 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DYNIHYLYYWLKHHYNVHFNGLECKTPEEYKGWSVGKYIRSYYEECPKDKLPAYPESFDQDTEDDEWEKKHRDHTAKKQSVII |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012817 (88%), Mouse ENSMUSG00000039883 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.