
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRPPRC Antibody
상품 한눈에 보기
Human LRPPRC 단백질을 인식하는 고품질 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합합니다. siRNA 노크다운 및 독립 항체 비교를 통한 검증 완료. 토끼 유래 IgG로, PrEST 항원 친화 정제 및 높은 종간 특이성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036408-100 Anti-LRPPRC Antibody, leucine-rich pentatricopeptide repeat containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036408-25 Anti-LRPPRC Antibody, leucine-rich pentatricopeptide repeat containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRPPRC Antibody
Anti-LRPPRC Antibody
Leucine-rich pentatricopeptide repeat containing (LRPPRC)
Polyclonal antibody against human LRPPRC.
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in western blot by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
| 항목 | 내용 |
|---|---|
| Product Type | Polyclonal Antibody |
| Target Protein | Leucine-rich pentatricopeptide repeat containing |
| Target Gene | LRPPRC |
| Alternative Gene Names | GP130, LRP130, LSFC |
| Host | Rabbit |
| Isotype | IgG |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000024120 (92%), Rat ENSRNOG00000005877 (88%) |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Clonality | Polyclonal |
| Supplier | Atlas Antibodies |
Antigen Sequence
RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVTNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



