
Atlas Antibodies Anti-LRPPRC Antibody
상품 한눈에 보기
Human LRPPRC 단백질을 인식하는 고품질 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합합니다. siRNA 노크다운 및 독립 항체 비교를 통한 검증 완료. 토끼 유래 IgG로, PrEST 항원 친화 정제 및 높은 종간 특이성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRPPRC Antibody
Leucine-rich pentatricopeptide repeat containing (LRPPRC)
Polyclonal antibody against human LRPPRC.
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in western blot by siRNA knockdown.
- ICC: Suitable for immunocytochemistry applications.
Product Description
| 항목 | 내용 |
|---|---|
| Product Type | Polyclonal Antibody |
| Target Protein | Leucine-rich pentatricopeptide repeat containing |
| Target Gene | LRPPRC |
| Alternative Gene Names | GP130, LRP130, LSFC |
| Host | Rabbit |
| Isotype | IgG |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000024120 (92%), Rat ENSRNOG00000005877 (88%) |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Clonality | Polyclonal |
| Supplier | Atlas Antibodies |
Antigen Sequence
RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVTNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
- Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LRRC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRPPRC Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRPPRC Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRPAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRP6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.