Atlas Antibodies Anti-LRPPRC Antibody

상품 한눈에 보기

Human LRPPRC 단백질을 인식하는 고품질 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합합니다. siRNA 노크다운 및 독립 항체 비교를 통한 검증 완료. 토끼 유래 IgG로, PrEST 항원 친화 정제 및 높은 종간 특이성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036408-100 Anti-LRPPRC Antibody, leucine-rich pentatricopeptide repeat containing 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036408-25 Anti-LRPPRC Antibody, leucine-rich pentatricopeptide repeat containing 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Leucine-rich pentatricopeptide repeat containing (LRPPRC)
Polyclonal antibody against human LRPPRC.

IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic Validation): Genetic validation in western blot by siRNA knockdown.
ICC: Suitable for immunocytochemistry applications.

항목	내용
Product Type	Polyclonal Antibody
Target Protein	Leucine-rich pentatricopeptide repeat containing
Target Gene	LRPPRC
Alternative Gene Names	GP130, LRP130, LSFC
Host	Rabbit
Isotype	IgG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000024120 (92%), Rat ENSRNOG00000005877 (88%)
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Clonality	Polyclonal
Supplier	Atlas Antibodies

RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet
Open Datasheet