CacheBy
Atlas Antibodies Anti-ADRA1B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADRA1B Antibody

상품 한눈에 보기

인간 ADRA1B 단백질을 인식하는 토끼 폴리클로날 항체. ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간, 생쥐, 랫드 간 교차 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA074416-100 Anti-ADRA1B Antibody, adrenoceptor alpha 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074416-25 Anti-ADRA1B Antibody, adrenoceptor alpha 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADRA1B Antibody

Anti-ADRA1B Antibody

Target: adrenoceptor alpha 1B (ADRA1B)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ADRA1B protein.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG


Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000050541) – 96%
  • Rat (ENSRNOG00000060087) – 94%

Specifications

항목 내용
Target Protein adrenoceptor alpha 1B
Target Gene ADRA1B
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Store at -20°C (avoid repeated freeze-thaw cycles)
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.