CacheBy
Atlas Antibodies Anti-ADIPOQ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADIPOQ Antibody

상품 한눈에 보기

인간 ADIPOQ 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB 응용에 적합하며, 토끼에서 생산된 IgG 형식입니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051767-100 Anti-ADIPOQ Antibody, adiponectin, C1Q and collagen domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051767-25 Anti-ADIPOQ Antibody, adiponectin, C1Q and collagen domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADIPOQ Antibody

Anti-ADIPOQ Antibody

Target: adiponectin, C1Q and collagen domain containing
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human ADIPOQ.


Alternative Gene Names

ACDC, ACRP30, adiponectin, AdipoQ, apM1, GBP28

Open Datasheet


Target Information

  • Protein: adiponectin, C1Q and collagen domain containing
  • Gene: ADIPOQ
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000022878 92%
Rat ENSRNOG00000001821 92%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.