Atlas Antibodies Anti-ADIPOQ Antibody
상품 옵션 정보 | ||||||
---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 가격 | 가격(VAT포함) | 수량 / 장바구니 |
HPA051767-100 | Atlas Antibodies HPA051767-100 Anti-ADIPOQ Antibody, adiponectin, C1Q and collagen domain containing 100ul | 재고문의 | 100ul | 728,000원 | 800,800원 | |
HPA051767-25 | Atlas Antibodies HPA051767-25 Anti-ADIPOQ Antibody, adiponectin, C1Q and collagen domain containing 25ul | 재고문의 | 25ul | 528,000원 | 580,800원 |
다른 상품 둘러보기
Anti-ADIPOQ Antibody
adiponectin, C1Q and collagen domain containing
Recommended Applications
Product Description
Polyclonal Antibody against Human ADIPOQ
Alternative Gene Names
ACDC, ACRP30, adiponectin, AdipoQ, apM1, GBP28
Target Protein
adiponectin, C1Q and collagen domain containing
Target Gene
ADIPOQ
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000022878 (92%)
Rat ENSRNOG00000001821 (92%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|