
Atlas Antibodies Anti-ADIPOQ Antibody
상품 한눈에 보기
인간 ADIPOQ 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB 응용에 적합하며, 토끼에서 생산된 IgG 형식입니다. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ADIPOQ Antibody
Target: adiponectin, C1Q and collagen domain containing
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human ADIPOQ.
Alternative Gene Names
ACDC, ACRP30, adiponectin, AdipoQ, apM1, GBP28
Target Information
- Protein: adiponectin, C1Q and collagen domain containing
- Gene: ADIPOQ
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000022878 | 92% |
| Rat | ENSRNOG00000001821 | 92% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ADIG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADIPOQ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADIPOR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADNP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.