
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRCH1 Antibody
상품 한눈에 보기
인간 LRCH1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등에 적합합니다. Rabbit 호스트 기반 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 다양한 종 간 교차 반응성이 검증되어 연구용으로 최적화된 제품입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021536-100 Anti-LRCH1 Antibody, leucine-rich repeats and calponin homology (CH) domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021536-25 Anti-LRCH1 Antibody, leucine-rich repeats and calponin homology (CH) domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRCH1 Antibody
Anti-LRCH1 Antibody
Target Information
- Target Protein: leucine-rich repeats and calponin homology (CH) domain containing 1
- Target Gene: LRCH1
- Alternative Gene Names: CHDC1, KIAA1016
Product Description
Polyclonal Antibody against Human LRCH1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LHQHVEDGKKDSDSGVGSDNGDKRLSATEPSDEDTVSLNVPMSNIMEEEQIIKEDSCHRLSPVKGEFHQEFQPEPSLLGDSTNSGEERDQFTDRADGLHSEFMNYKATTAEDC
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000009412 | 74% |
| Mouse | ENSMUSG00000068015 | 74% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



