
Atlas Antibodies Anti-LPCAT1 Antibody
상품 한눈에 보기
Human LPCAT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. RNA-seq 데이터 기반 직교 검증을 통해 단백질 발현을 확인하였으며, 고순도 Affinity 정제 방식으로 제조되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LPCAT1 Antibody
Target: lysophosphatidylcholine acyltransferase 1 (LPCAT1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): RNA-seq 데이터와 비교하여 고·저발현 조직에서 단백질 발현 직교 검증
- WB (Western Blot)
Product Description
Polyclonal antibody against Human LPCAT1
Alternative Gene Names
AYTL2, FLJ12443
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTC
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021608 | 99% |
| Rat | ENSRNOG00000017930 | 99% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LPCAT4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LPCAT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LPCAT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LPAR5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LPAR4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.