CacheBy
Atlas Antibodies Anti-LPCAT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LPCAT1 Antibody

상품 한눈에 보기

Human LPCAT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. RNA-seq 데이터 기반 직교 검증을 통해 단백질 발현을 확인하였으며, 고순도 Affinity 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012501-100 Anti-LPCAT1 Antibody, lysophosphatidylcholine acyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012501-25 Anti-LPCAT1 Antibody, lysophosphatidylcholine acyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LPCAT1 Antibody

Anti-LPCAT1 Antibody

Target: lysophosphatidylcholine acyltransferase 1 (LPCAT1)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): RNA-seq 데이터와 비교하여 고·저발현 조직에서 단백질 발현 직교 검증
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human LPCAT1


Alternative Gene Names

AYTL2, FLJ12443

Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTC

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000021608 99%
Rat ENSRNOG00000017930 99%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.