Atlas Antibodies Anti-LMNA Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-LMNA Antibody는 인간 Lamin A/C 단백질을 인식하는 고품질 폴리클로날 항체입니다. IHC 및 WB 분석에 추천되며, RNA-seq 데이터 기반 Orthogonal Validation을 통해 검증되었습니다. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제 방식으로 제조되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA006660-100 Anti-LMNA Antibody, lamin A/C 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA006660-25 Anti-LMNA Antibody, lamin A/C 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-LMNA Antibody

Anti-LMNA Antibody

Target Information

Target Protein: Lamin A/C
Target Gene: LMNA
Alternative Gene Names: CMD1A, HGPS, LGMD1B, LMN1, LMNL1, PRO1

Product Description

Polyclonal antibody against human LMNA.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000019638	99%
Mouse	ENSMUSG00000028063	99%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand