CacheBy
Atlas Antibodies Anti-LMNA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LMNA Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-LMNA Antibody는 인간 Lamin A/C 단백질을 인식하는 고품질 폴리클로날 항체입니다. IHC 및 WB 분석에 추천되며, RNA-seq 데이터 기반 Orthogonal Validation을 통해 검증되었습니다. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006660-100 Anti-LMNA Antibody, lamin A/C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006660-25 Anti-LMNA Antibody, lamin A/C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LMNA Antibody

Anti-LMNA Antibody

Target Information

  • Target Protein: Lamin A/C
  • Target Gene: LMNA
  • Alternative Gene Names: CMD1A, HGPS, LGMD1B, LMN1, LMNL1, PRO1

Product Description

Polyclonal antibody against human LMNA.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    EVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000019638 99%
Mouse ENSMUSG00000028063 99%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.