
Atlas Antibodies Anti-LMNA Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-LMNA Antibody는 인간 Lamin A/C 단백질을 인식하는 고품질 폴리클로날 항체입니다. IHC 및 WB 분석에 추천되며, RNA-seq 데이터 기반 Orthogonal Validation을 통해 검증되었습니다. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제 방식으로 제조되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LMNA Antibody
Target Information
- Target Protein: Lamin A/C
- Target Gene: LMNA
- Alternative Gene Names: CMD1A, HGPS, LGMD1B, LMN1, LMNL1, PRO1
Product Description
Polyclonal antibody against human LMNA.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000019638 | 99% |
| Mouse | ENSMUSG00000028063 | 99% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LMNTD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LMNB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LMNA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LMNTD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LMNTD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.