
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LHPP Antibody
상품 한눈에 보기
Human LHPP 단백질을 인식하는 폴리클로날 항체로, IHC·WB·ICC 실험에 적합함. Rabbit 호스트에서 생산되었으며, PrEST 항원을 이용해 친화 정제됨. Human, Mouse, Rat 반응성이 검증됨. 고품질 단백질 발현 검증용 연구 시약.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA009163-100 Anti-LHPP Antibody, phospholysine phosphohistidine inorganic pyrophosphate phosphatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009163-25 Anti-LHPP Antibody, phospholysine phosphohistidine inorganic pyrophosphate phosphatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LHPP Antibody
Anti-LHPP Antibody
phospholysine phosphohistidine inorganic pyrophosphate phosphatase
Recommended Applications
- IHC (Independent validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human LHPP
Alternative Gene Names
HDHD2B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | phospholysine phosphohistidine inorganic pyrophosphate phosphatase |
| Target Gene | LHPP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (AA) | LISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVD |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000030946 (95%)
- Rat ENSRNOG00000017097 (93%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



