Atlas Antibodies Anti-LGR4 Antibody
상품 한눈에 보기
Human LGR4 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종간 보존성을 가짐. GPR48로도 알려진 LGR4 타깃 검출에 사용.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LGR4 Antibody
Target: leucine-rich repeat containing G protein-coupled receptor 4 (LGR4, GPR48)
Type: Polyclonal Antibody against Human LGR4
Host: Rabbit
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody raised in rabbit against human LGR4 (leucine-rich repeat containing G protein-coupled receptor 4).
Alternative gene name: GPR48
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine-rich repeat containing G protein-coupled receptor 4 |
| Target Gene | LGR4 |
| Alternative Gene Name | GPR48 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
Interspecies Information:
Highest antigen sequence identity observed in:
- Mouse (ENSMUSG00000050199) – 95%
- Rat (ENSRNOG00000005715) – 92%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.