
원본
Atlas Antibodies Anti-LGR4 Antibody
상품 한눈에 보기
Human LGR4 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종간 보존성을 가짐. GPR48로도 알려진 LGR4 타깃 검출에 사용.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030267-100 Anti-LGR4 Antibody, leucine-rich repeat containing G protein-coupled receptor 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030267-25 Anti-LGR4 Antibody, leucine-rich repeat containing G protein-coupled receptor 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LGR4 Antibody
Anti-LGR4 Antibody
Target: leucine-rich repeat containing G protein-coupled receptor 4 (LGR4, GPR48)
Type: Polyclonal Antibody against Human LGR4
Host: Rabbit
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody raised in rabbit against human LGR4 (leucine-rich repeat containing G protein-coupled receptor 4).
Alternative gene name: GPR48
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine-rich repeat containing G protein-coupled receptor 4 |
| Target Gene | LGR4 |
| Alternative Gene Name | GPR48 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
Interspecies Information:
Highest antigen sequence identity observed in:
- Mouse (ENSMUSG00000050199) – 95%
- Rat (ENSRNOG00000005715) – 92%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



