
Atlas Antibodies Anti-LEXM Antibody
상품 한눈에 보기
인간 LEXM 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. 고순도 Affinity 정제 방식으로 제조. 인간에 특이적 반응성을 보이며, 면역세포 관련 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LEXM Antibody
Target: Lymphocyte Expansion Molecule (LEXM)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human LEXM.
Alternative Gene Names
C1orf177, FLJ40201, LEM
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
SHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVSHIGPGTYSSKETCFSKKKLMKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Lymphocyte Expansion Molecule |
| Target Gene | LEXM |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat (71%), Mouse (71%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as ligand |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LGALS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LEXM Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LFNG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.