CacheBy
Atlas Antibodies Anti-LEPR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LEPR Antibody

상품 한눈에 보기

인간 LEPR(Leptin receptor)을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 분석에 적합하며, PrEST 항원으로 특이적 정제됨. 인간에 반응하며 마우스 및 랫과 높은 서열 유사성 보유. 안정적 PBS/glycerol 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030899-100 Anti-LEPR Antibody, leptin receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030899-25 Anti-LEPR Antibody, leptin receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LEPR Antibody

Anti-LEPR Antibody

Target Information

  • Target Protein: Leptin receptor
  • Target Gene: LEPR
  • Alternative Gene Names: CD295, OBR
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LEPR.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    IYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRYAEL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000057722 79%
Rat ENSRNOG00000023664 78%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

Component Description
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.