
Atlas Antibodies Anti-LDB1 Antibody
상품 한눈에 보기
인간 LDB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. CLIM2/NLI로도 알려진 LDB1 단백질 검출에 사용되며, 고순도 Affinity Purified 방식으로 제작되었습니다. 인간, 생쥐, 랫드 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LDB1 Antibody
Target: LIM domain binding 1 (LDB1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human LDB1 protein.
Also known as CLIM2 or NLI.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LIM domain binding 1 |
| Target Gene | LDB1 |
| Alternative Gene Names | CLIM2, NLI |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW |
Species Reactivity
- Verified: Human, Mouse, Rat
- Interspecies Information:
- Rat (ENSRNOG00000018468): 100% identity
- Mouse (ENSMUSG00000025223): 100% identity
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
