CacheBy
Atlas Antibodies Anti-LDB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LDB1 Antibody

상품 한눈에 보기

인간 LDB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. CLIM2/NLI로도 알려진 LDB1 단백질 검출에 사용되며, 고순도 Affinity Purified 방식으로 제작되었습니다. 인간, 생쥐, 랫드 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034488-100 Anti-LDB1 Antibody, LIM domain binding 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034488-25 Anti-LDB1 Antibody, LIM domain binding 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LDB1 Antibody

Anti-LDB1 Antibody

Target: LIM domain binding 1 (LDB1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LDB1 protein.
Also known as CLIM2 or NLI.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein LIM domain binding 1
Target Gene LDB1
Alternative Gene Names CLIM2, NLI
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW

Species Reactivity

  • Verified: Human, Mouse, Rat
  • Interspecies Information:
    • Rat (ENSRNOG00000018468): 100% identity
    • Mouse (ENSMUSG00000025223): 100% identity

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.