CacheBy
Atlas Antibodies Anti-LBR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LBR Antibody

상품 한눈에 보기

인간 LBR 단백질에 대한 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 확인함. Rabbit 유래 IgG 항체로 PrEST 항원 친화 정제. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유. Glycerol/PBS buffer로 안정화 처리됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062236-100 Anti-LBR Antibody, lamin B receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062236-25 Anti-LBR Antibody, lamin B receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LBR Antibody

Anti-LBR Antibody

Target: Lamin B receptor (LBR)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human LBR


Alternative Gene Names

  • DHCR14B
  • TDRD18

Open Datasheet


Target Information

항목 내용
Target Protein Lamin B receptor
Target Gene LBR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000052574 (89%), Mouse ENSMUSG00000004880 (87%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.