
Atlas Antibodies Anti-LARS Antibody
상품 한눈에 보기
Human LARS 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도의 IgG 형태로 제공됩니다. 인간에 대해 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LARS Antibody
Target Information
- Target Protein: leucyl-tRNA synthetase
- Target Gene: LARS
- Alternative Gene Names: FLJ10595, FLJ21788, HSPC192, LARS1, LEUS, RNTLS
Product Description
Polyclonal antibody against human LARS (leucyl-tRNA synthetase).
Recommended for use in immunohistochemistry (IHC) and immunocytochemistry (ICC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
EHWLDYFPPLAIQDLKRMGLKVDWRRSFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIYSPKDGQPCMDHDRQTGEGVGPQEYTLLKLKVL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024493 | 96% |
| Rat | ENSRNOG00000018304 | 96% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
