
Atlas Antibodies Anti-LARP4 Antibody
상품 한눈에 보기
인간 LARP4 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC, WB, ICC에 적합하며 siRNA 노크다운으로 유전적 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LARP4 Antibody
La ribonucleoprotein domain family, member 4
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human LARP4.
Alternative Gene Names
- PP13296
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | La ribonucleoprotein domain family, member 4 |
| Target Gene | LARP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGR |
| Verified Species Reactivity | Human |
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000023025 (82%)
- Rat ENSRNOG00000020423 (27%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LARP6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LARP7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LARP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LARP4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LARP4B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.