
Atlas Antibodies Anti-LANCL1 Antibody
상품 한눈에 보기
Human LANCL1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. GPR69A(p40) 대체 유전자명으로 알려진 LANCL1을 표적하며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human, Mouse, Rat 종에 반응합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LANCL1 Antibody
LanC lantibiotic synthetase component C-like 1 (bacterial)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human LANCL1
Alternative Gene Names
GPR69A, p40
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LanC lantibiotic synthetase component C-like 1 (bacterial) |
| Target Gene | LANCL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000026000 (91%), Rat ENSRNOG00000013557 (91%) |
Antigen Sequence:
MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LARGE2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAPTM5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LANCL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LAPTM4A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.