Thermo Fisher Scientific EFEMP2 Polyclonal Antibody
Rabbit polyclonal antibody against human EFEMP2. Validated for IHC (paraffin) applications. Purified by antigen affinity chromatography and supplied in PBS with glycerol. Suitable for research use in studying connective tissue and elastic fiber formation.
- 카탈로그번호
- PA554742
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific EFEMP2 Polyclonal Antibody
Applications
- Immunohistochemistry (Paraffin) (IHC (P)): 1:20–1:50 dilution
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human EFEMP2. Recombinant protein control fragment (Product # RP-88789) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.05 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2640917 |
Product Specific Information
Immunogen sequence:
RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHR
Highest antigen sequence identity to the following orthologs:
- Mouse: 93%
- Rat: 93%
Target Information
EFEMP2 contains epidermal growth factor (EGF) domains and is implicated in diverse functions such as blood coagulation, complement activation, and cell fate determination during development. The protein includes four EGF2 domains and six calcium-binding EGF2 domains. It is essential for elastic fiber formation and connective tissue development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.