Thermo Fisher Scientific EFEMP2 Polyclonal Antibody
Rabbit polyclonal antibody against human EFEMP2. Validated for IHC (paraffin) applications. Purified by antigen affinity chromatography and supplied in PBS with glycerol. Suitable for research use in studying connective tissue and elastic fiber formation.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Immunohistochemistry (Paraffin) (IHC (P)): 1:20–1:50 dilution
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human EFEMP2. Recombinant protein control fragment (Product # RP-88789) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.05 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2640917 |
Product Specific Information
Immunogen sequence:
RDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDSCVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHR
Highest antigen sequence identity to the following orthologs:
- Mouse: 93%
- Rat: 93%
Target Information
EFEMP2 contains epidermal growth factor (EGF) domains and is implicated in diverse functions such as blood coagulation, complement activation, and cell fate determination during development. The protein includes four EGF2 domains and six calcium-binding EGF2 domains. It is essential for elastic fiber formation and connective tissue development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Niban-like protein Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific EFCAB13 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific EFEMP2 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific CCDC25 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific NECAB1 Polyclonal Antibody
799,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|