원본
Thermo Fisher Scientific KV1.3 (KCNA3) Polyclonal Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human KV1.3 (KCNA3), validated for WB, IHC(F), ICC/IF, and IP. Lyophilized form with 0.6 mg/mL concentration, stored at -20°C. Suitable for research use in neuronal potassium channel studies.
- 카탈로그번호
- PA577571
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 06:23
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA577571 KV1.3 (KCNA3) Polyclonal Antibody 50 ul pk판매 단위 pk ·
재고 확인 필요
943,000원VAT 포함 1,037,300원
Thermo Fisher Scientific · Thermo Fisher Scientific KV1.3 (KCNA3) Polyclonal Antibody
Thermo Fisher Scientific KV1.3 (KCNA3) Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:200 | |
| Immunohistochemistry (Frozen) (IHC (F)) | Assay-Dependent | |
| Immunocytochemistry (ICC/IF) | 1:200 | |
| Immunoprecipitation (IP) | Assay-Dependent |
Product Specifications
| Specification | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523–575 of human Kv1.3 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.6 mg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2736056 |
Product Specific Information
- Product is shipped at room temperature as a lyophilized powder.
- Store at -20°C upon receipt.
- Reconstitution: Add 50 µL of deionized water.
Target Information
Voltage-dependent potassium channels in neurons are key determinants of resting membrane potential and membrane excitability, influencing the frequency and shape of action potentials.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific KV1.5 (KCNA5) Polyclonal Antibody922,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Kir1.1 (KCNJ1) Polyclonal Antibody943,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific OPRL1 Polyclonal Antibody943,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific OPRK1 (extracellular) Polyclonal Antibody가격 문의VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.