Thermo Fisher Scientific KV1.3 (KCNA3) Polyclonal Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human KV1.3 (KCNA3), validated for WB, IHC(F), ICC/IF, and IP. Lyophilized form with 0.6 mg/mL concentration, stored at -20°C. Suitable for research use in neuronal potassium channel studies.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific KV1.3 (KCNA3) Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Notes |
|---|---|---|
| Western Blot (WB) | 1:200 | |
| Immunohistochemistry (Frozen) (IHC (F)) | Assay-Dependent | |
| Immunocytochemistry (ICC/IF) | 1:200 | |
| Immunoprecipitation (IP) | Assay-Dependent |
Product Specifications
| Specification | Description |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523–575 of human Kv1.3 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.6 mg/mL |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2736056 |
Product Specific Information
- Product is shipped at room temperature as a lyophilized powder.
- Store at -20°C upon receipt.
- Reconstitution: Add 50 µL of deionized water.
Target Information
Voltage-dependent potassium channels in neurons are key determinants of resting membrane potential and membrane excitability, influencing the frequency and shape of action potentials.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.5 (KCNA5) Polyclonal Antibody
922,300원
Thermo Fisher Scientific
Thermo Fisher Scientific Kir1.1 (KCNJ1) Polyclonal Antibody
943,000원
Thermo Fisher Scientific
Thermo Fisher Scientific KV1.3 (KCNA3) Polyclonal Antibody
943,000원
Thermo Fisher Scientific
Thermo Fisher Scientific OPRL1 Polyclonal Antibody
943,000원
Thermo Fisher Scientific
Thermo Fisher Scientific OPRK1 (extracellular) Polyclonal Antibody
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.