CacheBy
Atlas Antibodies Anti-ADGRE3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRE3 Antibody

상품 한눈에 보기

인간 ADGRE3 단백질을 인식하는 폴리클로날 항체입니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. IHC 등 다양한 연구 응용에 적합합니다. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015638-100 Anti-ADGRE3 Antibody, adhesion G protein-coupled receptor E3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015638-25 Anti-ADGRE3 Antibody, adhesion G protein-coupled receptor E3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRE3 Antibody

Anti-ADGRE3 Antibody

Target: adhesion G protein-coupled receptor E3
Supplier: Atlas Antibodies


면역조직화학(IHC)


Product Description

Polyclonal Antibody against Human ADGRE3


Alternative Gene Names

EMR3

Open Datasheet


Target Information

  • Target Protein: adhesion G protein-coupled receptor E3
  • Target Gene: ADGRE3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    NASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVL

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000002885 31%
Rat ENSRNOG00000004489 29%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.