CacheBy
Atlas Antibodies Anti-ADGRB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRB2 Antibody

상품 한눈에 보기

인간 ADGRB2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. 면역세포화학(ICC) 등 다양한 연구 응용에 적합. 높은 종 간 교차 반응성(쥐 96%, 생쥐 94%)을 보유. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 순도 제공.

카탈로그번호
HPA052612-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052612-100 Anti-ADGRB2 Antibody, adhesion G protein-coupled receptor B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052612-25 Anti-ADGRB2 Antibody, adhesion G protein-coupled receptor B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRB2 Antibody

Anti-ADGRB2 Antibody

Target: adhesion G protein-coupled receptor B2 (ADGRB2)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ADGRB2.


Alternative Gene Names

  • BAI2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein adhesion G protein-coupled receptor B2
Target Gene ADGRB2
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014375 (96%), Mouse ENSMUSG00000028782 (94%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.