CacheBy
Atlas Antibodies Anti-ADGRD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRD1 Antibody

상품 한눈에 보기

인간 ADGRD1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 연구 응용에 적합합니다. Human 반응성이 검증되었으며, GPR133 등 대체 유전자명으로도 알려져 있습니다.

카탈로그번호
HPA042395-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042395-100 Anti-ADGRD1 Antibody, adhesion G protein-coupled receptor D1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042395-25 Anti-ADGRD1 Antibody, adhesion G protein-coupled receptor D1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRD1 Antibody

Anti-ADGRD1 Antibody

Target: adhesion G protein-coupled receptor D1 (ADGRD1)
Supplier: Atlas Antibodies


Immunohistochemistry (IHC)


Product Description

Polyclonal antibody against human ADGRD1.


Alternative Gene Names

  • DKFZp434B1272
  • GPR133
  • PGR25

Open Datasheet (PDF)


Target Information

  • Target Protein: adhesion G protein-coupled receptor D1
  • Target Gene: ADGRD1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000044017 91%
Rat ENSRNOG00000023536 86%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.